PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 312aa    MW: 34896.7 Da    PI: 6.0019
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033111genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.23.3e-39101101101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkC+++C lapyfpa++p++f+n+hklFG++n++k+l++l++++r++am+s++++A++r   Pv+G++  i +lq +++q+++el++++
  Lus10033111  10 ACAACKYQRRKCTSECQLAPYFPANRPETFRNAHKLFGVRNIVKILEKLDHHQRQEAMQSIIWQANIRDIYPVRGCLDYIYALQYKIHQAQEELHAVH 107
                  7************************************************************************************************9 PP

       DUF260  99 eel 101
                  ++l
  Lus10033111 108 SQL 110
                  985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.1339110IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-3710107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MTLNGGTSHA CAACKYQRRK CTSECQLAPY FPANRPETFR NAHKLFGVRN IVKILEKLDH  60
HQRQEAMQSI IWQANIRDIY PVRGCLDYIY ALQYKIHQAQ EELHAVHSQL QVYRNQQATD  120
RPFPEDDMVI TSSHLQLGMA PPPAAAANSN ALSLFGHHNE HPPEQVVALQ SPELQHSYCM  180
SINNNVVGGG GYSSGYLDNK DNAVGNSFWL HHNYGINNDE VINSSSMGLQ SQLVAAPNHP  240
LGIQQELVHD YNEMHPFFDT IDDRQSYIDS TKEAYDTSSE ESIKDTTQSL EHIAENELKS  300
AAACFSITSV N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511502.11e-113PREDICTED: LOB domain-containing protein 27
TrEMBLB9R9271e-113B9R927_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0012s07390.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-56LOB domain-containing protein 27